(data stored in ACNUC7421 zone)

EMBL: CP001958.PE261

CP001958.PE261       Location/Qualifiers
FT   CDS             complement(242206..242946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96754"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96754.1"
FT                   /translation="MRRLLTALIATGLLAGPAAAPALADQASVCAQAGGAWREHGEYPR
FT                   HTDEARCEFQESLSDDRTVSYSSPVPGDMLGDEWVESQLAAFIKSRFAQLRSSIPSAPQ
FT                   TSVSGDIDEHHDYRHSASVQSLVFHETVSVSAAAHPNDECLTLTFDLAEHRQLRISDLF
FT                   KAGTNIPATITPLVLRDAKQGTLGQLSIGTYNDGSYSAFALTPTDLVVYLPAERVGAVN
FT                   AGAFSATIPLSAFGDTLRPEYRSS"
     MRRLLTALIA TGLLAGPAAA PALADQASVC AQAGGAWREH GEYPRHTDEA RCEFQESLSD        60
     DRTVSYSSPV PGDMLGDEWV ESQLAAFIKS RFAQLRSSIP SAPQTSVSGD IDEHHDYRHS       120
     ASVQSLVFHE TVSVSAAAHP NDECLTLTFD LAEHRQLRIS DLFKAGTNIP ATITPLVLRD       180
     AKQGTLGQLS IGTYNDGSYS AFALTPTDLV VYLPAERVGA VNAGAFSATI PLSAFGDTLR       240
     PEYRSS                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page