(data stored in ACNUC7421 zone)

EMBL: CP001958.PE263

CP001958.PE263       Location/Qualifiers
FT   CDS             complement(243694..244401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_1497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96756"
FT                   /db_xref="GOA:D6ZAZ7"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ7"
FT                   /inference="similar to AA sequence:KEGG:SACE_1497"
FT                   /protein_id="ADG96756.1"
FT                   /translation="MRRETQHLILLLLGGAVLKISLNGNYARYVKPALGPWLTATGAAA
FT                   VLLAVALIAASFRSKPTEHEHEHEHHHSSRMAWLLMVPALVLLFAPPPVLTVDQPPAQA
FT                   QAAPADPAPYPPLPPGQPSMKLIDFVGRALGAPATLDGREVSLVGFVRKLPDGLYLARV
FT                   FIWCCAADARSVVLKLDVDPARAPAQDLADKQWVRLIGTYVPGSIDNDPEDIPTVRVIH
FT                   VAPIPPPENPYET"
     MRRETQHLIL LLLGGAVLKI SLNGNYARYV KPALGPWLTA TGAAAVLLAV ALIAASFRSK        60
     PTEHEHEHEH HHSSRMAWLL MVPALVLLFA PPPVLTVDQP PAQAQAAPAD PAPYPPLPPG       120
     QPSMKLIDFV GRALGAPATL DGREVSLVGF VRKLPDGLYL ARVFIWCCAA DARSVVLKLD       180
     VDPARAPAQD LADKQWVRLI GTYVPGSIDN DPEDIPTVRV IHVAPIPPPE NPYET            235
//

If you have problems or comments...

PBIL Back to PBIL home page