(data stored in ACNUC7421 zone)

EMBL: CP001958.PE265

CP001958.PE265       Location/Qualifiers
FT   CDS             245481..246686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0271"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: rop:ROP_51020
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96758"
FT                   /db_xref="GOA:D6ZAZ9"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ9"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ADG96758.1"
FT                   /translation="MASSVPFVLAVCGLGACGQDKAAPPPPPPPAPPSAPPNTTTTPTS
FT                   VPPGTKLSSQEAPADWKRLLPPGADATLIRYRSVSGLDGSATEVGGVVLTPAGPAPKEG
FT                   WPIITVGHGLTGVRGDCGAAEHPLLASVTKRLAPLVKAGYLVVMSDYQGLSSAGTHPFL
FT                   DPKTAAYNLIDAVAAARQLVPQHSNKWAAMGHSQGGQAAWAALEHAKEYGKSFQFVGAV
FT                   ALAPAVNGAAAFDAALHGKLTKLQESLFPALIAGYLARHPDGKWEDFLSGALLENHDVL
FT                   LSCAPEDMQKRAAVLSRITPGDVVPDTEQAQAKLRAWLEEVSLPKTAGDGPLLVVQGAK
FT                   DELIEPEWTREAVRQGCALGLRVQEIVRPGQGHADVEDDKDVLDWLGARFAGDQPAPTS
FT                   CE"
     MASSVPFVLA VCGLGACGQD KAAPPPPPPP APPSAPPNTT TTPTSVPPGT KLSSQEAPAD        60
     WKRLLPPGAD ATLIRYRSVS GLDGSATEVG GVVLTPAGPA PKEGWPIITV GHGLTGVRGD       120
     CGAAEHPLLA SVTKRLAPLV KAGYLVVMSD YQGLSSAGTH PFLDPKTAAY NLIDAVAAAR       180
     QLVPQHSNKW AAMGHSQGGQ AAWAALEHAK EYGKSFQFVG AVALAPAVNG AAAFDAALHG       240
     KLTKLQESLF PALIAGYLAR HPDGKWEDFL SGALLENHDV LLSCAPEDMQ KRAAVLSRIT       300
     PGDVVPDTEQ AQAKLRAWLE EVSLPKTAGD GPLLVVQGAK DELIEPEWTR EAVRQGCALG       360
     LRVQEIVRPG QGHADVEDDK DVLDWLGARF AGDQPAPTSC E                           401
//

If you have problems or comments...

PBIL Back to PBIL home page