(data stored in ACNUC7421 zone)

EMBL: CP001958.PE266

CP001958.PE266       Location/Qualifiers
FT   CDS             246714..247355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96759"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB00"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro04825"
FT                   /protein_id="ADG96759.1"
FT                   /translation="MRLAHFGQSCVLVEHAGTKVLIDPGSFSHGFEGVSGLDAILITHQ
FT                   HADHVDQSRLGPLIELNPQAALVTDAQTQEILGEGWQKVVPGDSFAAGALNVRVVGGKH
FT                   AVIVPDVPVVDNLGFIFGDESEPDLFYHPGDALHVPERSPQVLAVPTGGPWMRVSDGVE
FT                   FLRAVKARLSVPVHGETERFPQSYTDRYAEYGPAGAELRILPREEAVEVA"
     MRLAHFGQSC VLVEHAGTKV LIDPGSFSHG FEGVSGLDAI LITHQHADHV DQSRLGPLIE        60
     LNPQAALVTD AQTQEILGEG WQKVVPGDSF AAGALNVRVV GGKHAVIVPD VPVVDNLGFI       120
     FGDESEPDLF YHPGDALHVP ERSPQVLAVP TGGPWMRVSD GVEFLRAVKA RLSVPVHGET       180
     ERFPQSYTDR YAEYGPAGAE LRILPREEAV EVA                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page