(data stored in ACNUC7421 zone)

EMBL: CP001958.PE269

CP001958.PE269       Location/Qualifiers
FT   CDS             complement(249488..250582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0275"
FT                   /product="inositol 1-phosphate synthase"
FT                   /note="KEGG: mab:MAB_4907 myo-inositol-1-phosphate
FT                   synthase; TIGRFAM: inositol 1-phosphate synthase; PFAM:
FT                   Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96762"
FT                   /db_xref="GOA:D6ZB03"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB03"
FT                   /inference="protein motif:TFAM:TIGR03450"
FT                   /protein_id="ADG96762.1"
FT                   /translation="MSENANEVRVAIVGVGNCAASLVQGVQYYQDADEDATVPGLMHVR
FT                   FGPYHVRDVKFVAAFDVDAKKVGFDLSEAIFASQNNTIKISDVPPQDVTVLRGPTLDGL
FT                   GKYYMQTIEEAPGEAADVVAALKAAKADVLVSYLPVGSEEADRFYAQCAIDAGVAFVNA
FT                   LPVFIASDPVWAKKFEDAGVPIVGDDIKSQVGATITHRVMAKLFEDRGVVLDRTYQLNV
FT                   GGNMDFKNMLERDRLESKKVSKTQAVTSNLQGSLAGKVYDRNVHIGPSDYVEWLDDRKW
FT                   AYVRLEGRAFGDVPLSLEYKLEVWDSPNSAGIIIDAVRAAKIALDRGIGGPVYPASAYL
FT                   MKSPPRQLADDVARAQLETFISGE"
     MSENANEVRV AIVGVGNCAA SLVQGVQYYQ DADEDATVPG LMHVRFGPYH VRDVKFVAAF        60
     DVDAKKVGFD LSEAIFASQN NTIKISDVPP QDVTVLRGPT LDGLGKYYMQ TIEEAPGEAA       120
     DVVAALKAAK ADVLVSYLPV GSEEADRFYA QCAIDAGVAF VNALPVFIAS DPVWAKKFED       180
     AGVPIVGDDI KSQVGATITH RVMAKLFEDR GVVLDRTYQL NVGGNMDFKN MLERDRLESK       240
     KVSKTQAVTS NLQGSLAGKV YDRNVHIGPS DYVEWLDDRK WAYVRLEGRA FGDVPLSLEY       300
     KLEVWDSPNS AGIIIDAVRA AKIALDRGIG GPVYPASAYL MKSPPRQLAD DVARAQLETF       360
     ISGE                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page