(data stored in ACNUC7421 zone)

EMBL: CP001958.PE27

CP001958.PE27        Location/Qualifiers
FT   CDS             26959..27198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GD10068 gene product from transcript GD10068-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96520"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96520.1"
FT                   /translation="MNYGSTPYGSGQGKSLEEVLDIAGIVHKALRLPFAHHPVVAAHIR
FT                   DVTARLEEWESMFLPDEEIPFVGVDRGEITGASA"
     MNYGSTPYGS GQGKSLEEVL DIAGIVHKAL RLPFAHHPVV AAHIRDVTAR LEEWESMFLP        60
     DEEIPFVGVD RGEITGASA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page