(data stored in ACNUC7421 zone)

EMBL: CP001958.PE272

CP001958.PE272       Location/Qualifiers
FT   CDS             252216..252587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_4746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96765"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB06"
FT                   /inference="similar to AA sequence:KEGG:Gbro_4746"
FT                   /protein_id="ADG96765.1"
FT                   /translation="MEYGLQRRSRLADYQAGLVARGEICDADRFLLLAAKFHGQASTTL
FT                   CPVCGKERLTLVSWVFGDSLGPASGSARGEAELAQLSLARGEFTVHVVEVCRGCSWNFL
FT                   IRSYVTGTAKTRAKRGASR"
     MEYGLQRRSR LADYQAGLVA RGEICDADRF LLLAAKFHGQ ASTTLCPVCG KERLTLVSWV        60
     FGDSLGPASG SARGEAELAQ LSLARGEFTV HVVEVCRGCS WNFLIRSYVT GTAKTRAKRG       120
     ASR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page