(data stored in ACNUC7421 zone)

EMBL: CP001958.PE277

CP001958.PE277       Location/Qualifiers
FT   CDS             255454..255909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0283"
FT                   /product="ribosomal protein L9"
FT                   /note="KEGG: nca:Noca_4661 50S ribosomal protein L9P;
FT                   TIGRFAM: ribosomal protein L9; PFAM: Ribosomal protein
FT                   L9-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96770"
FT                   /db_xref="GOA:D6ZB11"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB11"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ADG96770.1"
FT                   /translation="MQLILTKKVAGLGGAGDLVEVKEGYARNFLLPRKLAITGTASAQK
FT                   QAENIRTAAAQREARAHDRAEELKAKLAEVGKVAVPARAGNTGKLFGSVTPAQVAAAIS
FT                   NAAGSQVDAGDVRLAAHQIRSLGQYEIEVDLGAGLTSKVKLDIVAAQ"
     MQLILTKKVA GLGGAGDLVE VKEGYARNFL LPRKLAITGT ASAQKQAENI RTAAAQREAR        60
     AHDRAEELKA KLAEVGKVAV PARAGNTGKL FGSVTPAQVA AAISNAAGSQ VDAGDVRLAA       120
     HQIRSLGQYE IEVDLGAGLT SKVKLDIVAA Q                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page