(data stored in ACNUC7421 zone)

EMBL: CP001958.PE28

CP001958.PE28        Location/Qualifiers
FT   CDS             27195..27479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CBP1; corticosteroid-binding protein; likely
FT                   Flavin containing amine oxidoreductase; one of two genes
FT                   similar to S. cerevisiae spermine oxidase FMS1 (YMR020W)
FT                   involved in beta-alanine/pantothenate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96521"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96521.1"
FT                   /translation="MSGGLVLRLPRRDFPKLIEERARVLNEAMRLFLSAYDDECSEAVT
FT                   DEEREWCRNTRRYMDDWFGDVLSEVEQYAFPDAEDIEADRACDLAREVA"
     MSGGLVLRLP RRDFPKLIEE RARVLNEAMR LFLSAYDDEC SEAVTDEERE WCRNTRRYMD        60
     DWFGDVLSEV EQYAFPDAED IEADRACDLA REVA                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page