(data stored in ACNUC7421 zone)

EMBL: CP001958.PE280

CP001958.PE280       Location/Qualifiers
FT   CDS             258963..259205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0286"
FT                   /product="TolA protein, putative"
FT                   /note="KEGG: mca:MCA1228 TolA protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96773"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB14"
FT                   /inference="similar to AA sequence:KEGG:MCA1228"
FT                   /protein_id="ADG96773.1"
FT                   /translation="MAKADDLYLMQLELQKRTKASMQAVDQGFQAIRDEERRQADQREK
FT                   RAEQEAAATPEGRARAAWDAASDPRRWGSYEDEEG"
     MAKADDLYLM QLELQKRTKA SMQAVDQGFQ AIRDEERRQA DQREKRAEQE AAATPEGRAR        60
     AAWDAASDPR RWGSYEDEEG                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page