(data stored in ACNUC7421 zone)

EMBL: CP001958.PE283

CP001958.PE283       Location/Qualifiers
FT   CDS             260166..260999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0289"
FT                   /product="chitinase-like protein"
FT                   /note="KEGG: mxa:MXAN_7387 chitinase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96776"
FT                   /db_xref="GOA:D6ZB17"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB17"
FT                   /inference="protein motif:COG:COG3179"
FT                   /protein_id="ADG96776.1"
FT                   /translation="MRGDIQNSVVNAFALVCQALDKADNEVKTHIEENYDVLLKALDAQ
FT                   GGPPPPLSEEALGRVMPKLAKDPQKLHEYYEMLLQTMRENGIDDPKAQITFLATLAEES
FT                   DQFTAPGLEELWDEKYGDNPPYDARAHYYQVVDGLEGDDWVYHGRGYIQLTNRANYQAA
FT                   QDYLRQHGYPNIDLMGHPEQASDPKTAAATAGWFWKNHGADLSRVAAAGDPSTAFTNVT
FT                   MGVNGAVNGEVAPAAQYPTRAEYYNALVTEYREMLAARGVPESSLPTTIDTAPRY"
     MRGDIQNSVV NAFALVCQAL DKADNEVKTH IEENYDVLLK ALDAQGGPPP PLSEEALGRV        60
     MPKLAKDPQK LHEYYEMLLQ TMRENGIDDP KAQITFLATL AEESDQFTAP GLEELWDEKY       120
     GDNPPYDARA HYYQVVDGLE GDDWVYHGRG YIQLTNRANY QAAQDYLRQH GYPNIDLMGH       180
     PEQASDPKTA AATAGWFWKN HGADLSRVAA AGDPSTAFTN VTMGVNGAVN GEVAPAAQYP       240
     TRAEYYNALV TEYREMLAAR GVPESSLPTT IDTAPRY                                277
//

If you have problems or comments...

PBIL Back to PBIL home page