(data stored in ACNUC7421 zone)

EMBL: CP001958.PE289

CP001958.PE289       Location/Qualifiers
FT   CDS             complement(266917..267222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0295"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   mav:MAV_5178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96782"
FT                   /db_xref="GOA:D6ZB23"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB23"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADG96782.1"
FT                   /translation="MWVMEETTPPPAPRRAPEDMAAVLGRLRRAHGQLGGVIAMIEQER
FT                   SCRDVVTQLAAVSRALDRAGFKIIATGLRDCVAEPDGTPGHGLTVDELEKLFLSLA"
     MWVMEETTPP PAPRRAPEDM AAVLGRLRRA HGQLGGVIAM IEQERSCRDV VTQLAAVSRA        60
     LDRAGFKIIA TGLRDCVAEP DGTPGHGLTV DELEKLFLSL A                           101
//

If you have problems or comments...

PBIL Back to PBIL home page