(data stored in ACNUC7421 zone)

EMBL: CP001958.PE290

CP001958.PE290       Location/Qualifiers
FT   CDS             267453..268523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0296"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   fre:Franean1_4201 alpha/beta hydrolase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96783"
FT                   /db_xref="GOA:D6ZB24"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB24"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADG96783.1"
FT                   /translation="MRHVRFFHRFRPGAVRRGAGALCVGAVVLAAGCDHGSARSATSTP
FT                   PPAMRVVKDVQYAGGAADADRSGHMLDLYLPQGAAKAVPLVIWTNGSAFLFPAGRDRGD
FT                   LFANRLVPRGYAVAAVAVRGSGQATFPAQRDDTLAAVAFLRRNAAQYGLDPARFAYMGH
FT                   SSGGWSSAVAGVEGSGESAVQAAVALSPVTDVAATAKEALPDDMWRIAEEQRRSNVPGV
FT                   PGFRGDHEAADSPEGKFLGGRVSDNMDKAAAASPALHVAPAGPPFLIVHGTEDEYVPFA
FT                   QGTTLYFALKQAGRDVTFVMLPGASHRATLPPWSAESVKNATSAHSTGGRTPDVSAVSG
FT                   DGWDVILGFLDAHLKP"
     MRHVRFFHRF RPGAVRRGAG ALCVGAVVLA AGCDHGSARS ATSTPPPAMR VVKDVQYAGG        60
     AADADRSGHM LDLYLPQGAA KAVPLVIWTN GSAFLFPAGR DRGDLFANRL VPRGYAVAAV       120
     AVRGSGQATF PAQRDDTLAA VAFLRRNAAQ YGLDPARFAY MGHSSGGWSS AVAGVEGSGE       180
     SAVQAAVALS PVTDVAATAK EALPDDMWRI AEEQRRSNVP GVPGFRGDHE AADSPEGKFL       240
     GGRVSDNMDK AAAASPALHV APAGPPFLIV HGTEDEYVPF AQGTTLYFAL KQAGRDVTFV       300
     MLPGASHRAT LPPWSAESVK NATSAHSTGG RTPDVSAVSG DGWDVILGFL DAHLKP           356
//

If you have problems or comments...

PBIL Back to PBIL home page