(data stored in ACNUC7421 zone)

EMBL: CP001958.PE293

CP001958.PE293       Location/Qualifiers
FT   CDS             complement(269946..271133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0299"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   rop:ROP_53450 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96786"
FT                   /db_xref="GOA:D6ZB27"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB27"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADG96786.1"
FT                   /translation="MTTFDTITAADVLDRVRDLLPLIREHAAQNERDRKIADEVIAALR
FT                   DAGAFRLAAPRRFGGLEAGLRAMLDLSALIAEADGGTSWVTTLSNINAWSTCLYDAATV
FT                   DEIYADGPDAILSGVVSPGGTARATPGGYLIRGEWPYCSASLHADWVSGGVWEVDENGD
FT                   EIDQSMVVMRASDVQIKDTWHVAGMRSSGSNTIVADDVFVPSHRVSSMLPVVSGDSVEQ
FT                   YPDNPFYRSAFAPMLVLVLIGPQLGLGRAALDIAVKKASTKALAYTNIEQQADSVAFQL
FT                   LVADAATKIDTAHLHAYRAADDVERYAEQGVYPDVAARARMRADAAVALTSVNDAINTL
FT                   LNACGAGSFADVNPLQRIWRDANVGQRHAVILPQVSMETYGKALLGRTDHITAIL"
     MTTFDTITAA DVLDRVRDLL PLIREHAAQN ERDRKIADEV IAALRDAGAF RLAAPRRFGG        60
     LEAGLRAMLD LSALIAEADG GTSWVTTLSN INAWSTCLYD AATVDEIYAD GPDAILSGVV       120
     SPGGTARATP GGYLIRGEWP YCSASLHADW VSGGVWEVDE NGDEIDQSMV VMRASDVQIK       180
     DTWHVAGMRS SGSNTIVADD VFVPSHRVSS MLPVVSGDSV EQYPDNPFYR SAFAPMLVLV       240
     LIGPQLGLGR AALDIAVKKA STKALAYTNI EQQADSVAFQ LLVADAATKI DTAHLHAYRA       300
     ADDVERYAEQ GVYPDVAARA RMRADAAVAL TSVNDAINTL LNACGAGSFA DVNPLQRIWR       360
     DANVGQRHAV ILPQVSMETY GKALLGRTDH ITAIL                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page