(data stored in ACNUC7421 zone)

EMBL: CP001958.PE294

CP001958.PE294       Location/Qualifiers
FT   CDS             complement(271482..272741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0300"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: mab:MAB_4608
FT                   3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96787"
FT                   /db_xref="GOA:D6ZB28"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB28"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADG96787.1"
FT                   /translation="MARPSTANGGFPSIVVTGMAMMSAIAPDVEGTWQGLLDGESGIRA
FT                   LEDDFAAGLDLPVRIGGRLKVRDFDKDLTKVEHRRMSYVQRMATVLGRQAWADAGSPDG
FT                   VDEARLAVAIGAGMGSVRGMAEAYDEMREKGARAISPFTVQMFMANGPAAVVGLERKAR
FT                   GGIITPVSACASGNEAIAHAWRQIAYGDADIAICGGVEAAIDAFAVAAFANMRIVLSTA
FT                   NDEPEKASRPFDKNRTGFVFGESGALLVIETEEHAKARGARSYARLLGAGITSDGHHLV
FT                   APHPDGVGAARAMTRALENAGLQPGDVGHVNAHATATSVGDLAEAKAIRLAGLQHAEVY
FT                   APKGAIGHSVGAVGAVEAVITVKTLQEGIIPPTLNLETPDPEIDLDVVSGEPRKSDHAY
FT                   AINNSFGFGGHNTATVFGKY"
     MARPSTANGG FPSIVVTGMA MMSAIAPDVE GTWQGLLDGE SGIRALEDDF AAGLDLPVRI        60
     GGRLKVRDFD KDLTKVEHRR MSYVQRMATV LGRQAWADAG SPDGVDEARL AVAIGAGMGS       120
     VRGMAEAYDE MREKGARAIS PFTVQMFMAN GPAAVVGLER KARGGIITPV SACASGNEAI       180
     AHAWRQIAYG DADIAICGGV EAAIDAFAVA AFANMRIVLS TANDEPEKAS RPFDKNRTGF       240
     VFGESGALLV IETEEHAKAR GARSYARLLG AGITSDGHHL VAPHPDGVGA ARAMTRALEN       300
     AGLQPGDVGH VNAHATATSV GDLAEAKAIR LAGLQHAEVY APKGAIGHSV GAVGAVEAVI       360
     TVKTLQEGII PPTLNLETPD PEIDLDVVSG EPRKSDHAYA INNSFGFGGH NTATVFGKY        419
//

If you have problems or comments...

PBIL Back to PBIL home page