(data stored in ACNUC7421 zone)

EMBL: CP001958.PE296

CP001958.PE296       Location/Qualifiers
FT   CDS             complement(273642..274577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0302"
FT                   /product="cysteine synthase A"
FT                   /note="KEGG: rer:RER_10910 cysteine synthase; TIGRFAM:
FT                   cysteine synthase A; cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96789"
FT                   /db_xref="GOA:D6ZB30"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB30"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ADG96789.1"
FT                   /translation="MSKIYENVSDLVGHTPLVQLNRLTAGLPGRVVAKLEYYNPANSVK
FT                   DRVGVAIIDAAERSGELRPGGTIVEATSGNTGIALAMVGAARGYKVILTMPDTMSVERR
FT                   AMLRAFGAEIVLTPGSEGMAGAVERAKQIIAGTHNAVAANQFSNPANPAMHEQTTGEEI
FT                   WADTDGAVDVFVAGIGTGGTISGVGRALKARKPGVRIVGVEPKDSPILNGGAAGAHKIQ
FT                   GIGANFIPEVLDRDIYDEILDVEFADAIKVARALGVEEGILGGISAGANVWAALELAKR
FT                   PENAGKLIVTVVCDFGERYISTALFDHIRD"
     MSKIYENVSD LVGHTPLVQL NRLTAGLPGR VVAKLEYYNP ANSVKDRVGV AIIDAAERSG        60
     ELRPGGTIVE ATSGNTGIAL AMVGAARGYK VILTMPDTMS VERRAMLRAF GAEIVLTPGS       120
     EGMAGAVERA KQIIAGTHNA VAANQFSNPA NPAMHEQTTG EEIWADTDGA VDVFVAGIGT       180
     GGTISGVGRA LKARKPGVRI VGVEPKDSPI LNGGAAGAHK IQGIGANFIP EVLDRDIYDE       240
     ILDVEFADAI KVARALGVEE GILGGISAGA NVWAALELAK RPENAGKLIV TVVCDFGERY       300
     ISTALFDHIR D                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page