(data stored in ACNUC7421 zone)

EMBL: CP001958.PE298

CP001958.PE298       Location/Qualifiers
FT   CDS             275505..277337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0304"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="KEGG: mab:MAB_4762 hypothetical protein; TIGRFAM:
FT                   YhgE/Pip C-terminal domain protein; YhgE/Pip N-terminal
FT                   domain protein; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96791"
FT                   /db_xref="GOA:D6ZB32"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB32"
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /protein_id="ADG96791.1"
FT                   /translation="MLAGLAFGSEIKRFGRSRLTRAAIVVLALLPLVYGALYLWAYWDP
FT                   FGHVNKMPVALVNADRGAVVSGQRINVGDEIAKSLTQDGGLEWHVMSHEQARGGVDHGK
FT                   YYFMLELPPDFSEAVASPVTGQSKKAELIAVYNDANNYISSNIGRTAVDQVLTAVSTRI
FT                   SGQAVNQVLSVVLSSGSGIKQAADGARLLADGAAQVDDGAAQLSAAIDKATDPILAVGK
FT                   AASAVGGDTEQLQQAAVALRQANAQIGGIAKAQDGAAASLAGVIDQLSASDDPAARSSA
FT                   ETLRGVQNQLHEHQFTPQIRQQLTDGENAAISLTETLRSPGSPLRSALDQLGGKGRDLT
FT                   DKLAQLRAGAERLKSGTAQVRGGSSELAAKLADGAGQVPNWTPQQKDAIADTIGGPVHL
FT                   RASHLNAAPNFGTGMAPFFLTLALFFGAIVLWMVFRPLQNRAIAAQAPAFRVALASYLP
FT                   AALIGISQAVVLYCVVRFGLGMRAAHPVAMLAFMALVSFAFVALTQSVNALLGPAVGRV
FT                   LVMALLMVQLVSAGGMYPVETTSKPFQALHRYDPMTYGVNGLRQLVLGGVDSRLWQAVL
FT                   TLAAIMAGALAVSSVCARRNRLWNASRLIPAIKM"
     MLAGLAFGSE IKRFGRSRLT RAAIVVLALL PLVYGALYLW AYWDPFGHVN KMPVALVNAD        60
     RGAVVSGQRI NVGDEIAKSL TQDGGLEWHV MSHEQARGGV DHGKYYFMLE LPPDFSEAVA       120
     SPVTGQSKKA ELIAVYNDAN NYISSNIGRT AVDQVLTAVS TRISGQAVNQ VLSVVLSSGS       180
     GIKQAADGAR LLADGAAQVD DGAAQLSAAI DKATDPILAV GKAASAVGGD TEQLQQAAVA       240
     LRQANAQIGG IAKAQDGAAA SLAGVIDQLS ASDDPAARSS AETLRGVQNQ LHEHQFTPQI       300
     RQQLTDGENA AISLTETLRS PGSPLRSALD QLGGKGRDLT DKLAQLRAGA ERLKSGTAQV       360
     RGGSSELAAK LADGAGQVPN WTPQQKDAIA DTIGGPVHLR ASHLNAAPNF GTGMAPFFLT       420
     LALFFGAIVL WMVFRPLQNR AIAAQAPAFR VALASYLPAA LIGISQAVVL YCVVRFGLGM       480
     RAAHPVAMLA FMALVSFAFV ALTQSVNALL GPAVGRVLVM ALLMVQLVSA GGMYPVETTS       540
     KPFQALHRYD PMTYGVNGLR QLVLGGVDSR LWQAVLTLAA IMAGALAVSS VCARRNRLWN       600
     ASRLIPAIKM                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page