(data stored in ACNUC7421 zone)

EMBL: CP001958.PE300

CP001958.PE300       Location/Qualifiers
FT   CDS             278542..279342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0306"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: rop:ROP_52360
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96793"
FT                   /db_xref="GOA:D6ZB34"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB34"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG96793.1"
FT                   /translation="MVTEPNAKICQDAVRSALAEGATLRRSFGLLRAFRFESSDPDQFY
FT                   DPLAQDWLRILLAAWRAWRPEAELSALRALDVGGAEGRSAVLLADIVERSVLVDADPDG
FT                   CREALASGVPVVRGDGQRLPFADATFDLVASSNVGEHVPQPWRLADELLRVTRPGGMAV
FT                   FSYTVWLGPFGGHETGRWHWLGGRYAARRYARAHGRPPKNLFGVSLFAVSAADGLRWAR
FT                   RLPPGAVLLAALPRYHPRWAWWLVRLPWLRELLTSNLLLVVGKR"
     MVTEPNAKIC QDAVRSALAE GATLRRSFGL LRAFRFESSD PDQFYDPLAQ DWLRILLAAW        60
     RAWRPEAELS ALRALDVGGA EGRSAVLLAD IVERSVLVDA DPDGCREALA SGVPVVRGDG       120
     QRLPFADATF DLVASSNVGE HVPQPWRLAD ELLRVTRPGG MAVFSYTVWL GPFGGHETGR       180
     WHWLGGRYAA RRYARAHGRP PKNLFGVSLF AVSAADGLRW ARRLPPGAVL LAALPRYHPR       240
     WAWWLVRLPW LRELLTSNLL LVVGKR                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page