(data stored in ACNUC7421 zone)

EMBL: CP001958.PE302

CP001958.PE302       Location/Qualifiers
FT   CDS             281608..281922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96795"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB36"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_1872"
FT                   /protein_id="ADG96795.1"
FT                   /translation="MGGSLRSDSAELRAVQQLVSGIVDEMRVGFDGLAQHGDQLLEGWI
FT                   GVAASKFRAPWDEWKQGCKTVVDALEAESGLLGESADEYDQQEGVNSDSLANVDVRYNW
FT                   "
     MGGSLRSDSA ELRAVQQLVS GIVDEMRVGF DGLAQHGDQL LEGWIGVAAS KFRAPWDEWK        60
     QGCKTVVDAL EAESGLLGES ADEYDQQEGV NSDSLANVDV RYNW                        104
//

If you have problems or comments...

PBIL Back to PBIL home page