(data stored in ACNUC7421 zone)

EMBL: CP001958.PE305

CP001958.PE305       Location/Qualifiers
FT   CDS             283732..284289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0311"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: sin:YN1551_2013 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96798"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB39"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG96798.1"
FT                   /translation="MTNNIDVHSRDSLQQTPLHISVGDMWEPGDRTPSVDQLIAAGADV
FT                   NARDQWGRTPLHYASHSDRADAVAALIAAGADVNARDNGNWTPLHAAAARGCTAVVKLL
FT                   LDAGAEVEPIDSQGETPLSRAITAKSGVPEEVIKLLRERGANPWRKSGRHSPLSAARAH
FT                   TSGYHFQEIKEAFADLPDEEPK"
     MTNNIDVHSR DSLQQTPLHI SVGDMWEPGD RTPSVDQLIA AGADVNARDQ WGRTPLHYAS        60
     HSDRADAVAA LIAAGADVNA RDNGNWTPLH AAAARGCTAV VKLLLDAGAE VEPIDSQGET       120
     PLSRAITAKS GVPEEVIKLL RERGANPWRK SGRHSPLSAA RAHTSGYHFQ EIKEAFADLP       180
     DEEPK                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page