(data stored in ACNUC7421 zone)

EMBL: CP001958.PE306

CP001958.PE306       Location/Qualifiers
FT   CDS             284286..284726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ZNF692; zinc finger protein 692"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96799"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96799.1"
FT                   /translation="MSVLDTDGRLADMRVRAERFAARVEGIRGKGTRLNGRLVFEVDAR
FT                   KNPVNVAVDASIGQYNADSIAELFHGAARDACQDVDRQMREALVEFGEDQKTRELVREL
FT                   MGPLSPRLPPAPGAQQRQAEPQGPDPDDEEAWNDARSWLEKA"
     MSVLDTDGRL ADMRVRAERF AARVEGIRGK GTRLNGRLVF EVDARKNPVN VAVDASIGQY        60
     NADSIAELFH GAARDACQDV DRQMREALVE FGEDQKTREL VRELMGPLSP RLPPAPGAQQ       120
     RQAEPQGPDP DDEEAWNDAR SWLEKA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page