(data stored in ACNUC7421 zone)

EMBL: CP001958.PE307

CP001958.PE307       Location/Qualifiers
FT   CDS             complement(285023..285952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0313"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="KEGG: msm:MSMEG_6418 prephenate dehydratase; PFAM:
FT                   prephenate dehydratase; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96800"
FT                   /db_xref="GOA:D6ZB41"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB41"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADG96800.1"
FT                   /translation="MIAYFGPSGTFTEAAMLDFVRRGLAPDTGALALNSPQDVIAAVRD
FT                   GTARYGCVPVESTADGSVAPTLDGLVAGEPVQIVAETQLEVSFSVLLAPEADPDEVATV
FT                   AAYPVAAAQVRSWLAQRWPRAAVVPASSNAAAALDAAEGRADAAVTTPIMAERLSLREA
FT                   ARSVADITGSRTRFALISAPCAPPPRTGSDRTAVALRLAHAPGSLANAMNQLALRDLDL
FT                   IRIESRPTRNQPEPYWFFLDFVGHVDDPVVAEALKSLWQHSIEVFYLGSWSCESFGGAA
FT                   NRPIGVPPPSDEAARRWVAGLRSPSSRP"
     MIAYFGPSGT FTEAAMLDFV RRGLAPDTGA LALNSPQDVI AAVRDGTARY GCVPVESTAD        60
     GSVAPTLDGL VAGEPVQIVA ETQLEVSFSV LLAPEADPDE VATVAAYPVA AAQVRSWLAQ       120
     RWPRAAVVPA SSNAAAALDA AEGRADAAVT TPIMAERLSL REAARSVADI TGSRTRFALI       180
     SAPCAPPPRT GSDRTAVALR LAHAPGSLAN AMNQLALRDL DLIRIESRPT RNQPEPYWFF       240
     LDFVGHVDDP VVAEALKSLW QHSIEVFYLG SWSCESFGGA ANRPIGVPPP SDEAARRWVA       300
     GLRSPSSRP                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page