(data stored in ACNUC7421 zone)

EMBL: CP001958.PE308

CP001958.PE308       Location/Qualifiers
FT   CDS             complement(285949..286998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0314"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   nfa:nfa32360 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96801"
FT                   /db_xref="GOA:D6ZB42"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB42"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG96801.1"
FT                   /translation="MPDESHSGQRPAAWREGLREGPHAPFADRPEPDNAGARYKTLTYE
FT                   TTGRVARIVFNRPERGNAITPDTPLDLAAAVERADLDPRVHVILVSGRGKGFCGGYDLD
FT                   MFAENGGTSDAGAHETAPGAADNRAARAGTVLDPVAQAVNHNPWGVWDPMLDYAMMSRF
FT                   NRGFASLLHANKPTVAKLHGFCVAGGTDIALYADQIICASDTKIGYPPTRVWGVPAAGM
FT                   WAHRLGDQRAKRLLLTGDCISGKQAEEWGLAVEAPEPDELDECAENLVERIAMMPINQL
FT                   MMVKLALNSALINQGVANSTMVSTVFDGISRHTREGYAFQLRSMTAGFREAVRERDEPF
FT                   GDHKRAQFE"
     MPDESHSGQR PAAWREGLRE GPHAPFADRP EPDNAGARYK TLTYETTGRV ARIVFNRPER        60
     GNAITPDTPL DLAAAVERAD LDPRVHVILV SGRGKGFCGG YDLDMFAENG GTSDAGAHET       120
     APGAADNRAA RAGTVLDPVA QAVNHNPWGV WDPMLDYAMM SRFNRGFASL LHANKPTVAK       180
     LHGFCVAGGT DIALYADQII CASDTKIGYP PTRVWGVPAA GMWAHRLGDQ RAKRLLLTGD       240
     CISGKQAEEW GLAVEAPEPD ELDECAENLV ERIAMMPINQ LMMVKLALNS ALINQGVANS       300
     TMVSTVFDGI SRHTREGYAF QLRSMTAGFR EAVRERDEPF GDHKRAQFE                   349
//

If you have problems or comments...

PBIL Back to PBIL home page