(data stored in ACNUC7421 zone)

EMBL: CP001958.PE310

CP001958.PE310       Location/Qualifiers
FT   CDS             complement(289977..290390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0316"
FT                   /product="membrane family protein"
FT                   /note="PFAM: membrane family protein; KEGG: mab:MAB_2211c
FT                   putative membrane protein, MmpS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96803"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB44"
FT                   /inference="protein motif:PFAM:PF05423"
FT                   /protein_id="ADG96803.1"
FT                   /translation="MKSAWPYLVSLLILVAAGGFIAHLRSSSIPDEAVGFASALPKLGQ
FT                   SPQRTIDYEASGPAGTPVRVSYLDEHAQAHDADAVLPWQESLRTASPTVMTGLIVQSKA
FT                   GGVGCRIIIDGTVRDEQPPSASANVANCKVQVA"
     MKSAWPYLVS LLILVAAGGF IAHLRSSSIP DEAVGFASAL PKLGQSPQRT IDYEASGPAG        60
     TPVRVSYLDE HAQAHDADAV LPWQESLRTA SPTVMTGLIV QSKAGGVGCR IIIDGTVRDE       120
     QPPSASANVA NCKVQVA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page