(data stored in ACNUC7421 zone)

EMBL: CP001958.PE312

CP001958.PE312       Location/Qualifiers
FT   CDS             291905..298282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0318"
FT                   /product="Mycocerosate synthase"
FT                   /EC_number="2.3.1.111"
FT                   /note="KEGG: mab:MAB_2212 polyketide synthase; PFAM:
FT                   Beta-ketoacyl synthase; Acyl transferase; Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; KR domain protein;
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96805"
FT                   /db_xref="GOA:D6ZB46"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB46"
FT                   /inference="protein motif:PRIAM:2.3.1.111"
FT                   /protein_id="ADG96805.1"
FT                   /translation="MVAVAIVGIGCKFPGGIADADSFWDFILNKGDAVTDIPGDRWDVD
FT                   KYYDPDPDAPGRMYVRRGGFLTHQFQQFDADFFGISRREAAILDPQQRLLLETVWEALD
FT                   DAGLAGKVSGEEVGTFIGGFTNDNAVGRTSAHQLERINNFAATSSSQTLLANRLAYALD
FT                   LRGPSMTVDTACSSSLVATHLAVRAIESGECDVAIAGGSNVMFQPETFITMCKGRFLAA
FT                   DGRCKSFDAAADGYGRGEGVGAVVLKGLEQALRDGDRVYAVIRASGVNQDGRTPSLPVP
FT                   NPVSQQRLAERVLKEAGIDPALVGYVEAHGTGTNVGDPLELTALGNAYGRVPGRDDPLL
FT                   IGSVKNNFGHTEAAAGVAGLIKAALTVQRRIVAPQVWLEKLNPQIPFEELRLRVPMAAE
FT                   KYPDLRAPAFVAVNSFGYGGTNAHVLVEEPPAPRATGAVDGVRVFPLSARSEASLRGIA
FT                   RSYAQLLESDRSDEKAQRLKTAATGRRAHHFLRKGIVYRDADHLFEQLNAYADNDNVAP
FT                   GRVLVEGISEPVFVFSGMGPQWWAMGRGLLERPGVFRDTAEEVDAAFRAVSGWSVLEEL
FT                   LRPEGDSTISRTDVAQPANFLVQAALAKHVEQFGAKPVCVVGHSVGEVASAYVSGALSL
FT                   HDAATVAFHRSRLQAKTAGTGGMLAVGLGSDDARRRAERFADKVCVAAINSSAATTLAG
FT                   DFDALREIHAELVEEGIFARTLRVEVPYHSHLMEPILDELATALRGLVPRPAAIPVYST
FT                   VTGAQIDGEAFADPAYWQKNVREPVLFAQAIDTLIEERHRAFLEIGPHPVLAGNIRESF
FT                   VRHSVSGAAIPTLDRNVEAEQAVLQAVADLYAAGSIDVPGDAGLYSSSAVDHVDLPTYP
FT                   WAREQLWEEEPVTLRARYGDPDSFPLLGDRTGDTVSQWGLTLAPANLPWLPDHVVAGSV
FT                   VLPGTAYLDAALSAARQRTGRAHAGLDSVAFVAPLVIAEHDVPITRLSVEDATKRFVFK
FT                   GRSAHTQQWTTHAYGRLVEADPGSLTIDIPAPTQSDVAFAREAVYEGLSSVGLSYGPAF
FT                   QRIRSARIASDTCVAQLESPSLSGSGPARQHTVHPTLSDAALQCVAVLLAARPELVAVP
FT                   SAYVPASVDRVRFYHEVPENPLAVVEITSSQPLRANAYLASEDGDVALAMFGVTLRPVG
FT                   AAPSPLEELDRYFFEPRWEPADEEEHAPAAAPRAANAVVLIGNVAQSVEGGCRRAAGAG
FT                   ARVVRLASAAAERSAELAETLAAAMRDDAFVRVLVAVGDDGAPEENVHHIVAVARALTE
FT                   VLASDDTDQTVKADAQAVVVSRGAFFAPGDHDLNLAHAGLAGARRTIANEQLAVRWSLL
FT                   DTAVSATEDEVAEALGAAGATAALDEVAVRAGRRWVQRMRRSLPELTEAWETPFQAADP
FT                   EVAYEVQLPKSRLLKDIALRECDRVEPGPRQVEIRVETIGLNYKDPLKVIGILADRELE
FT                   GTYFGLEPGMEGFGVVTRVGSDVREVRVGDGLIVSERGLLRRYLTFDLDGGAAWAPLRH
FT                   EDFSDSEFDPLAIGSGLPFLTAAYAFRSLVGLQPGERVLVHGAAGGMGMGAVQLAVSMG
FT                   AVVYATAGTEERRRAALELGAAEVFDSRSVGFVDDVLRATQGRGVDVVYNSLPGEVIAQ
FT                   NFAVAGEFCRIVEIGKADIYFGGSMELKPFNRNLTFHSLDMDRLMRQRPDLFRQLLQEG
FT                   VGLLTDTRLRLLPYTRFSISDVAEAFEAVFRARHVGRIVVDLRDEAPMLLPRKAAPVAV
FT                   RPDGSYLITGGFGAFGLATARSLAREGATRLILVGRSGAVTSEVQAQVESLRASGVEVL
FT                   EKRIDIADYDQVAALVSDVESSGSPLRGVFHTAGVIFDEPIGKLTLDAARKVFAPKVVG
FT                   ALNLDRALREHGARIDSFVLYSSISALVGAAPQTSYAAANSALDAFAQWRRAQGLPALS
FT                   VNWGALSGGMAVTSDAVQSYLDFIGFRMVNMETAAALLHECSRFDLPHVAVMGIDWGRW
FT                   RNAMPAAAQSTRFSHLAAEAETVTNEQAAFRAAVLAAPEEERGPIVTKALAEQLAEVLG
FT                   VKAENLDPRGPLVDLGIDSLMAVEFGARAGKHLNIQVAAFQFTPDLTLEAVGARIAALI
FT                   VQEAAAESDQTSEKR"
     MVAVAIVGIG CKFPGGIADA DSFWDFILNK GDAVTDIPGD RWDVDKYYDP DPDAPGRMYV        60
     RRGGFLTHQF QQFDADFFGI SRREAAILDP QQRLLLETVW EALDDAGLAG KVSGEEVGTF       120
     IGGFTNDNAV GRTSAHQLER INNFAATSSS QTLLANRLAY ALDLRGPSMT VDTACSSSLV       180
     ATHLAVRAIE SGECDVAIAG GSNVMFQPET FITMCKGRFL AADGRCKSFD AAADGYGRGE       240
     GVGAVVLKGL EQALRDGDRV YAVIRASGVN QDGRTPSLPV PNPVSQQRLA ERVLKEAGID       300
     PALVGYVEAH GTGTNVGDPL ELTALGNAYG RVPGRDDPLL IGSVKNNFGH TEAAAGVAGL       360
     IKAALTVQRR IVAPQVWLEK LNPQIPFEEL RLRVPMAAEK YPDLRAPAFV AVNSFGYGGT       420
     NAHVLVEEPP APRATGAVDG VRVFPLSARS EASLRGIARS YAQLLESDRS DEKAQRLKTA       480
     ATGRRAHHFL RKGIVYRDAD HLFEQLNAYA DNDNVAPGRV LVEGISEPVF VFSGMGPQWW       540
     AMGRGLLERP GVFRDTAEEV DAAFRAVSGW SVLEELLRPE GDSTISRTDV AQPANFLVQA       600
     ALAKHVEQFG AKPVCVVGHS VGEVASAYVS GALSLHDAAT VAFHRSRLQA KTAGTGGMLA       660
     VGLGSDDARR RAERFADKVC VAAINSSAAT TLAGDFDALR EIHAELVEEG IFARTLRVEV       720
     PYHSHLMEPI LDELATALRG LVPRPAAIPV YSTVTGAQID GEAFADPAYW QKNVREPVLF       780
     AQAIDTLIEE RHRAFLEIGP HPVLAGNIRE SFVRHSVSGA AIPTLDRNVE AEQAVLQAVA       840
     DLYAAGSIDV PGDAGLYSSS AVDHVDLPTY PWAREQLWEE EPVTLRARYG DPDSFPLLGD       900
     RTGDTVSQWG LTLAPANLPW LPDHVVAGSV VLPGTAYLDA ALSAARQRTG RAHAGLDSVA       960
     FVAPLVIAEH DVPITRLSVE DATKRFVFKG RSAHTQQWTT HAYGRLVEAD PGSLTIDIPA      1020
     PTQSDVAFAR EAVYEGLSSV GLSYGPAFQR IRSARIASDT CVAQLESPSL SGSGPARQHT      1080
     VHPTLSDAAL QCVAVLLAAR PELVAVPSAY VPASVDRVRF YHEVPENPLA VVEITSSQPL      1140
     RANAYLASED GDVALAMFGV TLRPVGAAPS PLEELDRYFF EPRWEPADEE EHAPAAAPRA      1200
     ANAVVLIGNV AQSVEGGCRR AAGAGARVVR LASAAAERSA ELAETLAAAM RDDAFVRVLV      1260
     AVGDDGAPEE NVHHIVAVAR ALTEVLASDD TDQTVKADAQ AVVVSRGAFF APGDHDLNLA      1320
     HAGLAGARRT IANEQLAVRW SLLDTAVSAT EDEVAEALGA AGATAALDEV AVRAGRRWVQ      1380
     RMRRSLPELT EAWETPFQAA DPEVAYEVQL PKSRLLKDIA LRECDRVEPG PRQVEIRVET      1440
     IGLNYKDPLK VIGILADREL EGTYFGLEPG MEGFGVVTRV GSDVREVRVG DGLIVSERGL      1500
     LRRYLTFDLD GGAAWAPLRH EDFSDSEFDP LAIGSGLPFL TAAYAFRSLV GLQPGERVLV      1560
     HGAAGGMGMG AVQLAVSMGA VVYATAGTEE RRRAALELGA AEVFDSRSVG FVDDVLRATQ      1620
     GRGVDVVYNS LPGEVIAQNF AVAGEFCRIV EIGKADIYFG GSMELKPFNR NLTFHSLDMD      1680
     RLMRQRPDLF RQLLQEGVGL LTDTRLRLLP YTRFSISDVA EAFEAVFRAR HVGRIVVDLR      1740
     DEAPMLLPRK AAPVAVRPDG SYLITGGFGA FGLATARSLA REGATRLILV GRSGAVTSEV      1800
     QAQVESLRAS GVEVLEKRID IADYDQVAAL VSDVESSGSP LRGVFHTAGV IFDEPIGKLT      1860
     LDAARKVFAP KVVGALNLDR ALREHGARID SFVLYSSISA LVGAAPQTSY AAANSALDAF      1920
     AQWRRAQGLP ALSVNWGALS GGMAVTSDAV QSYLDFIGFR MVNMETAAAL LHECSRFDLP      1980
     HVAVMGIDWG RWRNAMPAAA QSTRFSHLAA EAETVTNEQA AFRAAVLAAP EEERGPIVTK      2040
     ALAEQLAEVL GVKAENLDPR GPLVDLGIDS LMAVEFGARA GKHLNIQVAA FQFTPDLTLE      2100
     AVGARIAALI VQEAAAESDQ TSEKR                                            2125
//

If you have problems or comments...

PBIL Back to PBIL home page