(data stored in ACNUC7421 zone)

EMBL: CP001958.PE314

CP001958.PE314       Location/Qualifiers
FT   CDS             complement(299193..300743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0320"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rha:RHA1_ro03944
FT                   succinic semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96807"
FT                   /db_xref="GOA:D6ZB48"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB48"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADG96807.1"
FT                   /translation="MPVPSPSTFARLGKLVAIDEPAERSSRAITEAFTGKELAQMPIGN
FT                   ETDVERAFARARAAQKEWAKTSLRSRAAILRRFQTLVFQKLDELADIVQAETGKARASA
FT                   VEEVLFVATAAGWYAANGPKILKEKRVKPAVPILMDARVRHLPKGVVGVISPWNYPMAL
FT                   SVQDANPAWLAGNAVIMKPDSQTPFSTLALSELLYEAGLPRDVLQTLPGPGQVVGNALA
FT                   EQADYLMFTGSTATGKSLAEQCGRRLIGFSGELGGKNPMIVTATANIRRAALGATRACF
FT                   SNSGQLCISIERIYVQEQVYEQFINEFVAQTKAMRLGAGYSSDIDMGSLISEAQLKTVD
FT                   DHVNDAVSKGAKVLIGGKARPDLGPYFYEPTVLGGVREGMTLYKEETFGPVVSVYPVKT
FT                   VAEAIAAANDTRYGLNCSVWAGTWREGQEIAGQIYSGSANVNEGFAAWASHEAPCGGTR
FT                   ESGAGRRNGAEGLLKYTETQGLVTQRFLSLSGERWFPGWLLQRILPTVMRLVRLLPGR"
     MPVPSPSTFA RLGKLVAIDE PAERSSRAIT EAFTGKELAQ MPIGNETDVE RAFARARAAQ        60
     KEWAKTSLRS RAAILRRFQT LVFQKLDELA DIVQAETGKA RASAVEEVLF VATAAGWYAA       120
     NGPKILKEKR VKPAVPILMD ARVRHLPKGV VGVISPWNYP MALSVQDANP AWLAGNAVIM       180
     KPDSQTPFST LALSELLYEA GLPRDVLQTL PGPGQVVGNA LAEQADYLMF TGSTATGKSL       240
     AEQCGRRLIG FSGELGGKNP MIVTATANIR RAALGATRAC FSNSGQLCIS IERIYVQEQV       300
     YEQFINEFVA QTKAMRLGAG YSSDIDMGSL ISEAQLKTVD DHVNDAVSKG AKVLIGGKAR       360
     PDLGPYFYEP TVLGGVREGM TLYKEETFGP VVSVYPVKTV AEAIAAANDT RYGLNCSVWA       420
     GTWREGQEIA GQIYSGSANV NEGFAAWASH EAPCGGTRES GAGRRNGAEG LLKYTETQGL       480
     VTQRFLSLSG ERWFPGWLLQ RILPTVMRLV RLLPGR                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page