(data stored in ACNUC7421 zone)

EMBL: CP001958.PE318

CP001958.PE318       Location/Qualifiers
FT   CDS             304473..305393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0324"
FT                   /product="ABC-type molybdate transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: mno:Mnod_2760 extracellular solute-binding
FT                   protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96811"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB52"
FT                   /inference="protein motif:COG:COG0725"
FT                   /protein_id="ADG96811.1"
FT                   /translation="MGGPLSAPVPMLVSSRQFSAVTLPPMAETQGAHRRSRSMVLAICF
FT                   ALGGASAVSAPPCAADPDGQLTVATSGGTAAALRALAAVYARGGGERVRLVFGPSMGET
FT                   PQTIPARIARGERIDVVVMVGSAVDRLADDGQLTGPIRPVACSHIAMAVRAGAPRPDIS
FT                   TLDSLRRALLEARSVAYSDSASGVFVATQLFPRLGVSDTMRGKAFQVPAVPVGEVVAQG
FT                   RAELGFQQLSELLPVKGIDVVGLLPSGAQLGTTYSGAAVSSSAHKDEAESFLSFLGGEQ
FT                   ARGVMETSGLEQGGCPEPDQDQDTD"
     MGGPLSAPVP MLVSSRQFSA VTLPPMAETQ GAHRRSRSMV LAICFALGGA SAVSAPPCAA        60
     DPDGQLTVAT SGGTAAALRA LAAVYARGGG ERVRLVFGPS MGETPQTIPA RIARGERIDV       120
     VVMVGSAVDR LADDGQLTGP IRPVACSHIA MAVRAGAPRP DISTLDSLRR ALLEARSVAY       180
     SDSASGVFVA TQLFPRLGVS DTMRGKAFQV PAVPVGEVVA QGRAELGFQQ LSELLPVKGI       240
     DVVGLLPSGA QLGTTYSGAA VSSSAHKDEA ESFLSFLGGE QARGVMETSG LEQGGCPEPD       300
     QDQDTD                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page