(data stored in ACNUC7421 zone)

EMBL: CP001958.PE319

CP001958.PE319       Location/Qualifiers
FT   CDS             305499..305993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96812"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96812.1"
FT                   /translation="MKVAVLWSLALAWPALAVFAGQRPAVADEPSEVVYRVMYPSLPPQ
FT                   ARKEYTITVRDGVAEFVVHAGSLEDPVLVRDAAVVPEDVVGELRSGEPGLAGPWGPAPL
FT                   CVGAFESELDVTTGQGPRHVTGSGCGGRAGAAIEAYIGPVKRLFDLDRLLGERRLAPDD
FT                   Q"
     MKVAVLWSLA LAWPALAVFA GQRPAVADEP SEVVYRVMYP SLPPQARKEY TITVRDGVAE        60
     FVVHAGSLED PVLVRDAAVV PEDVVGELRS GEPGLAGPWG PAPLCVGAFE SELDVTTGQG       120
     PRHVTGSGCG GRAGAAIEAY IGPVKRLFDL DRLLGERRLA PDDQ                        164
//

If you have problems or comments...

PBIL Back to PBIL home page