(data stored in ACNUC7421 zone)

EMBL: CP001958.PE32

CP001958.PE32        Location/Qualifiers
FT   CDS             29111..29863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96525"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96525.1"
FT                   /translation="MSGLVRIEKGRNHFYELDGERVDGVTTILSGGIPKAALMPWALKT
FT                   AAQFAVENWDELCGLGQFERVDQIKKAPWRERDEAANRGSEVHRLAERLMRGEEVTVPA
FT                   TLSGHVRSCVDFLDEWQPVPVLLECPVASRAERYAGTLDAVVDIPGEGRCLIDFKTSRS
FT                   GVHPETGLQLAAYRHADFALAGGEEVAMGGLGVERAFGVWLRPDGYSVHELRAGAEEFA
FT                   VFLSAARIARWAKTSKQVVGEALERQKH"
     MSGLVRIEKG RNHFYELDGE RVDGVTTILS GGIPKAALMP WALKTAAQFA VENWDELCGL        60
     GQFERVDQIK KAPWRERDEA ANRGSEVHRL AERLMRGEEV TVPATLSGHV RSCVDFLDEW       120
     QPVPVLLECP VASRAERYAG TLDAVVDIPG EGRCLIDFKT SRSGVHPETG LQLAAYRHAD       180
     FALAGGEEVA MGGLGVERAF GVWLRPDGYS VHELRAGAEE FAVFLSAARI ARWAKTSKQV       240
     VGEALERQKH                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page