(data stored in ACNUC7421 zone)

EMBL: CP001958.PE320

CP001958.PE320       Location/Qualifiers
FT   CDS             306253..306525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0326"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   nfa:nfa760 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96813"
FT                   /db_xref="GOA:D6ZB54"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB54"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADG96813.1"
FT                   /translation="MPKSKVRKKTDFTINPGAAGAGSARTAPSSTWYVALMLGFMLAGL
FT                   AWLVVYYIAAADLDALKWMADLQFWNLAIGFGLMVVGLLMTMRWH"
     MPKSKVRKKT DFTINPGAAG AGSARTAPSS TWYVALMLGF MLAGLAWLVV YYIAAADLDA        60
     LKWMADLQFW NLAIGFGLMV VGLLMTMRWH                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page