(data stored in ACNUC7421 zone)

EMBL: CP001958.PE323

CP001958.PE323       Location/Qualifiers
FT   CDS             complement(308783..309640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96816"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB57"
FT                   /inference="similar to AA sequence:KEGG:MAB_0843"
FT                   /protein_id="ADG96816.1"
FT                   /translation="MNLTAHAVRALTALSLALGVCGCGNSQPQQPDRGGVELVGLFRFD
FT                   PAAYLGPDKAPTGTWFQMLTPAGGVMSNANPGSPVWQVNGKPVPGAYTSLAPGVGGGLR
FT                   AGGYQSLPDPAFAGTPTDPKAGDSLADSVTQPTPFFLVKFSISTNATDPQTQRPVGPPK
FT                   VLLRTDGTLAADLSSWAATWNGQYFNQGAPKPRPAKDAQVQGAAQVKQVWDWAAQKFLD
FT                   APVADNIPQGDWATGSYDPATRHYSLQWRSLIVGGPFDKFTGLWHLEGVFEPSTGPVPH
FT                   GPSS"
     MNLTAHAVRA LTALSLALGV CGCGNSQPQQ PDRGGVELVG LFRFDPAAYL GPDKAPTGTW        60
     FQMLTPAGGV MSNANPGSPV WQVNGKPVPG AYTSLAPGVG GGLRAGGYQS LPDPAFAGTP       120
     TDPKAGDSLA DSVTQPTPFF LVKFSISTNA TDPQTQRPVG PPKVLLRTDG TLAADLSSWA       180
     ATWNGQYFNQ GAPKPRPAKD AQVQGAAQVK QVWDWAAQKF LDAPVADNIP QGDWATGSYD       240
     PATRHYSLQW RSLIVGGPFD KFTGLWHLEG VFEPSTGPVP HGPSS                       285
//

If you have problems or comments...

PBIL Back to PBIL home page