(data stored in ACNUC7421 zone)

EMBL: CP001958.PE324

CP001958.PE324       Location/Qualifiers
FT   CDS             complement(309637..310650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96817"
FT                   /db_xref="GOA:D6ZB58"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB58"
FT                   /inference="similar to AA sequence:KEGG:MAB_0842"
FT                   /protein_id="ADG96817.1"
FT                   /translation="MVELPKHGPELSKHEETAKKPDRGRARAAWLGEYWLWGVLVLLGA
FT                   AFMLAPIRLGMYSESAEGQRMVERFTPVLTDQRLHQLENHLAVIEAARAETAERRLPHD
FT                   DLSHSNTISFVAQFPETEARFSSWIATMRADEGAFGQLRSLPPFGLFPFVFGFAGLALV
FT                   VIGMTGLFSASARTRTALRSAAALVGVLLVLFPVTAGVFAHSSAGTKLLRDFRPILTEE
FT                   NVRWAQSEFVVIGPSSAELLNDLHTHPGANLPATKAFVDQWATISADFANVIEEFADNL
FT                   GHFQALERLNETTKPLGLDAFDEFGWFYLVPGLALVLVVGADVLLSRNRNNAQEQV"
     MVELPKHGPE LSKHEETAKK PDRGRARAAW LGEYWLWGVL VLLGAAFMLA PIRLGMYSES        60
     AEGQRMVERF TPVLTDQRLH QLENHLAVIE AARAETAERR LPHDDLSHSN TISFVAQFPE       120
     TEARFSSWIA TMRADEGAFG QLRSLPPFGL FPFVFGFAGL ALVVIGMTGL FSASARTRTA       180
     LRSAAALVGV LLVLFPVTAG VFAHSSAGTK LLRDFRPILT EENVRWAQSE FVVIGPSSAE       240
     LLNDLHTHPG ANLPATKAFV DQWATISADF ANVIEEFADN LGHFQALERL NETTKPLGLD       300
     AFDEFGWFYL VPGLALVLVV GADVLLSRNR NNAQEQV                                337
//

If you have problems or comments...

PBIL Back to PBIL home page