(data stored in ACNUC7421 zone)

EMBL: CP001958.PE329

CP001958.PE329       Location/Qualifiers
FT   CDS             314476..314970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0335"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   sgr:SGR_2715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96822"
FT                   /db_xref="GOA:D6ZB63"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB63"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ADG96822.1"
FT                   /translation="MYAQEENMAGKPRTSSSPAGPRPQIATWGQRAGACLIDFLILLPF
FT                   VVLDEMVKAHMASSGLYAGTSGGAAVASALLMLGLMVVWIWNVVVQQGRTGQTVGKETM
FT                   KIRLVGASSGEPVGKGRCFARQTAHLLDALPLFTGYLWPLWDENRQTFADKAARTVVVQ
FT                   M"
     MYAQEENMAG KPRTSSSPAG PRPQIATWGQ RAGACLIDFL ILLPFVVLDE MVKAHMASSG        60
     LYAGTSGGAA VASALLMLGL MVVWIWNVVV QQGRTGQTVG KETMKIRLVG ASSGEPVGKG       120
     RCFARQTAHL LDALPLFTGY LWPLWDENRQ TFADKAARTV VVQM                        164
//

If you have problems or comments...

PBIL Back to PBIL home page