(data stored in ACNUC7421 zone)

EMBL: CP001958.PE331

CP001958.PE331       Location/Qualifiers
FT   CDS             complement(318303..318785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0337"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="KEGG: mav:MAV_0174 ribonuclease activity regulator
FT                   protein RraA; TIGRFAM: regulator of ribonuclease activity
FT                   A; PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96824"
FT                   /db_xref="GOA:D6ZB65"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB65"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ADG96824.1"
FT                   /translation="MTAVNFTPTADLVDQIGEQVRSCDTQFRQYGGRRQFAGPVRTIRA
FT                   FQDNALIKSTLSTPGNGAVLVVDGSASVHTALVGDVIAKLAEDNGWAGLVLNGAVRDVA
FT                   ALAGLDLGVKALGSNPRKSGKTGAGELDVPVEFGGVVFRPGDLLHSDEDGIVLTER"
     MTAVNFTPTA DLVDQIGEQV RSCDTQFRQY GGRRQFAGPV RTIRAFQDNA LIKSTLSTPG        60
     NGAVLVVDGS ASVHTALVGD VIAKLAEDNG WAGLVLNGAV RDVAALAGLD LGVKALGSNP       120
     RKSGKTGAGE LDVPVEFGGV VFRPGDLLHS DEDGIVLTER                             160
//

If you have problems or comments...

PBIL Back to PBIL home page