(data stored in ACNUC7421 zone)

EMBL: CP001958.PE338

CP001958.PE338       Location/Qualifiers
FT   CDS             322882..323442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0344"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: nml:Namu_1177
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96831"
FT                   /db_xref="GOA:D6ZB72"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB72"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADG96831.1"
FT                   /translation="MSADENQGRAVSEEQETVTEDYLTDDENAALDAIESAEDETQGAG
FT                   SAPAREKAPLREFTEEIITVGRRKEAVVRLRLSLGTGKFTLNGRSLENYFPNRVHQQLV
FT                   KSPLVHADREGSVDVRATLHGGGISGQAGALRLALSRALIEASPEDRPALKVAGFLTRD
FT                   ARATERKKYGLKKARKAPQYSKR"
     MSADENQGRA VSEEQETVTE DYLTDDENAA LDAIESAEDE TQGAGSAPAR EKAPLREFTE        60
     EIITVGRRKE AVVRLRLSLG TGKFTLNGRS LENYFPNRVH QQLVKSPLVH ADREGSVDVR       120
     ATLHGGGISG QAGALRLALS RALIEASPED RPALKVAGFL TRDARATERK KYGLKKARKA       180
     PQYSKR                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page