(data stored in ACNUC7421 zone)

EMBL: CP001958.PE34

CP001958.PE34        Location/Qualifiers
FT   CDS             30516..30917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0034"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: rha:RHA1_ro03431 single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96527"
FT                   /db_xref="GOA:D6Z9K0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K0"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADG96527.1"
FT                   /translation="MAGDTVINVVGNLTADPELRFTPTGAAVANFTVASTPRVFDRQTN
FT                   QWQDGEALFLRCNIWREAAENVAESLVRGQRVIVVGRLKQRSFEKDGQKRTVVELEVDE
FT                   IGPSLRYSTAKVSRANRGGVSQSDEPDWR"
     MAGDTVINVV GNLTADPELR FTPTGAAVAN FTVASTPRVF DRQTNQWQDG EALFLRCNIW        60
     REAAENVAES LVRGQRVIVV GRLKQRSFEK DGQKRTVVEL EVDEIGPSLR YSTAKVSRAN       120
     RGGVSQSDEP DWR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page