(data stored in ACNUC7421 zone)

EMBL: CP001958.PE342

CP001958.PE342       Location/Qualifiers
FT   CDS             327084..327581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: KLTH0D01606p"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96835"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96835.1"
FT                   /translation="MDAAEQLYHLQRENQKQIQQLQHDTTQGFAYLRKSAEASARGVRQ
FT                   SLSATGPVSSRSADRGWDSSTRDVGGPTAPQQAKPFVEPIPAGAPAELRNILIRNQHME
FT                   LRWQREFAARLRRAGEDRAAAPQRQAGQVRQAEQRRAAQPDARKGRGWDDSTRRIGWSA
FT                   QD"
     MDAAEQLYHL QRENQKQIQQ LQHDTTQGFA YLRKSAEASA RGVRQSLSAT GPVSSRSADR        60
     GWDSSTRDVG GPTAPQQAKP FVEPIPAGAP AELRNILIRN QHMELRWQRE FAARLRRAGE       120
     DRAAAPQRQA GQVRQAEQRR AAQPDARKGR GWDDSTRRIG WSAQD                       165
//

If you have problems or comments...

PBIL Back to PBIL home page