(data stored in ACNUC7421 zone)

EMBL: CP001958.PE343

CP001958.PE343       Location/Qualifiers
FT   CDS             complement(327593..328423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_19100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96836"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB77"
FT                   /inference="similar to AA sequence:KEGG:RER_19100"
FT                   /protein_id="ADG96836.1"
FT                   /translation="MAKNPKPLLARLARTGPNRVARGDLGAAGLPGLVFSPVSGSNLPA
FT                   IVFAHGWMAHPKRYHRTLRHLASWGFIVAAPSAHRGLFASDKDFAADLSRAVEIVRAAS
FT                   IGANQARAQRVGLVGHGLGASASVLAAAKDPSVAAVAALWPSKTTAATVQAAEDVAAAG
FT                   LILTTVGEELSLTSNATELALAWGAVAALRAIPDFAPEDLPERRGPRGWFELDLGAGRS
FT                   VAHAQLTGWLLATLAKDKTYAAFADPDASLPGAAPLDASAVERNPVNAFRALLS"
     MAKNPKPLLA RLARTGPNRV ARGDLGAAGL PGLVFSPVSG SNLPAIVFAH GWMAHPKRYH        60
     RTLRHLASWG FIVAAPSAHR GLFASDKDFA ADLSRAVEIV RAASIGANQA RAQRVGLVGH       120
     GLGASASVLA AAKDPSVAAV AALWPSKTTA ATVQAAEDVA AAGLILTTVG EELSLTSNAT       180
     ELALAWGAVA ALRAIPDFAP EDLPERRGPR GWFELDLGAG RSVAHAQLTG WLLATLAKDK       240
     TYAAFADPDA SLPGAAPLDA SAVERNPVNA FRALLS                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page