(data stored in ACNUC7421 zone)

EMBL: CP001958.PE344

CP001958.PE344       Location/Qualifiers
FT   CDS             328442..328774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96837"
FT                   /db_xref="GOA:D6ZB78"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96837.1"
FT                   /translation="MSKAEKSITWTLWALLLIASTAVGVFGLVIGTIDVVLVIIGAANG
FT                   QDVDGWASLAWYFVCGALLVALPWSILGAVVAMARRRKRVWFWPVAALGVVVLLASGLG
FT                   RMCGVL"
     MSKAEKSITW TLWALLLIAS TAVGVFGLVI GTIDVVLVII GAANGQDVDG WASLAWYFVC        60
     GALLVALPWS ILGAVVAMAR RRKRVWFWPV AALGVVVLLA SGLGRMCGVL                  110
//

If you have problems or comments...

PBIL Back to PBIL home page