(data stored in ACNUC7421 zone)

EMBL: CP001958.PE351

CP001958.PE351       Location/Qualifiers
FT   CDS             335105..336124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0357"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: mav:MAV_4367 O-sialoglycoprotein endopeptidase; PFAM:
FT                   peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96844"
FT                   /db_xref="GOA:D6ZB85"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB85"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADG96844.1"
FT                   /translation="MIVLGIESSCDETGAGIVRVESDGALTLLADEVASSVREHVRFGG
FT                   VVPEIAARAHLEAMRPTVRRALRAAQIDKPDAVAVTVGPGLVGPLSVGVASAKAYALAW
FT                   GVPLYAVNHLGGHIAVDQIEHGPLPPAVALLVSGGHTQILKAHSMVEPLVELGATVDDA
FT                   AGEAFDKVARLLGLGYPGGPVVDALAQTGDPDAVRFPRPMTGPKDARYDFSFSGLKTAV
FT                   IRYLQAHPDAEKADVAAGFQEAAADVLTAKAVAAAKEHGASTLVLGGGACANSRIRGLA
FT                   QQRCAAEGIELRVPRPRLCTDNGAMIAAFGAGFAAAGAKPSPSDVGPLPGLDVGVSLL"
     MIVLGIESSC DETGAGIVRV ESDGALTLLA DEVASSVREH VRFGGVVPEI AARAHLEAMR        60
     PTVRRALRAA QIDKPDAVAV TVGPGLVGPL SVGVASAKAY ALAWGVPLYA VNHLGGHIAV       120
     DQIEHGPLPP AVALLVSGGH TQILKAHSMV EPLVELGATV DDAAGEAFDK VARLLGLGYP       180
     GGPVVDALAQ TGDPDAVRFP RPMTGPKDAR YDFSFSGLKT AVIRYLQAHP DAEKADVAAG       240
     FQEAAADVLT AKAVAAAKEH GASTLVLGGG ACANSRIRGL AQQRCAAEGI ELRVPRPRLC       300
     TDNGAMIAAF GAGFAAAGAK PSPSDVGPLP GLDVGVSLL                              339
//

If you have problems or comments...

PBIL Back to PBIL home page