(data stored in ACNUC7421 zone)

EMBL: CP001958.PE353

CP001958.PE353       Location/Qualifiers
FT   CDS             complement(337238..337846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0359"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="KEGG: rop:ROP_11290 oligoribonuclease; PFAM:
FT                   Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96846"
FT                   /db_xref="GOA:D6ZB87"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB87"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADG96846.1"
FT                   /translation="MGDTKDRLLWVDCEMTGLRPGFDQLIEIAALVTDGELNIIDDGID
FT                   LVIHAEEDKLAQMDEYVTNMHASSGLTEAVRASELSLAEAEERVLAYVKERFPAPRTAI
FT                   LAGNSIATDRSFLAKDMPELDAWLHYRMVDVSTIKELSRRWYPRIYFNQPEKGLAHRAL
FT                   ADIVESVRELRYYRSTAFVAQPGPSSEEIESVVKELTTG"
     MGDTKDRLLW VDCEMTGLRP GFDQLIEIAA LVTDGELNII DDGIDLVIHA EEDKLAQMDE        60
     YVTNMHASSG LTEAVRASEL SLAEAEERVL AYVKERFPAP RTAILAGNSI ATDRSFLAKD       120
     MPELDAWLHY RMVDVSTIKE LSRRWYPRIY FNQPEKGLAH RALADIVESV RELRYYRSTA       180
     FVAQPGPSSE EIESVVKELT TG                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page