(data stored in ACNUC7421 zone)

EMBL: CP001958.PE355

CP001958.PE355       Location/Qualifiers
FT   CDS             complement(338714..340795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0361"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; FAD-
FT                   dependent pyridine nucleotide-disulphide oxidoreductase;
FT                   KEGG: mtb:TBMG_02806 NADPH dependent 2,4-dienoyl- CoA
FT                   reductase FadH"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96848"
FT                   /db_xref="GOA:D6ZB89"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB89"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG96848.1"
FT                   /translation="MNTSIRRPAAEQPALPYPNLLSELDLGRTRLKNRVVMGSMHTGYE
FT                   DYPWMIDKLAAYYGERAAGGVGLIVTGGYAPNYLGSTVPLFGQFTTKLVAKSHRKITDA
FT                   VHEHGAKILLQILHTGRYAFHPLAVSASATSAPTTPFRAWKMPGWLIRSTIRDYARAAK
FT                   LAKAAGYDGIEVMGGEGYLINQFLAPLTNKRTDEWGGTPQKRRRFPVEITRQIRAAVGP
FT                   DFILQFRISLVDYVPEGQTWEEIVALAKELEEAGVDIFNTDIGWHEARVPTIVTSVPSG
FT                   AFVEYTHALAQQVDVPVIASNRINMPEAAEQILAETDVDLISMARPLLADPNWVNKAKA
FT                   GQSDLINTCIACNQACLDHAFAHKTVSCLLNPRAGRETQLQLLPTRKAKKVAVVGAGPA
FT                   GLATAVSLAERGHSVTLIEGDDRIGGQFLIASKIPGKEEFRHTLRYFQKQLEHHKVQVR
FT                   LNTRITAAQLSAEGFDDVVVATGVAPRMPRIPGVEHPMVLSYADVVKEGKPVGKRVAVI
FT                   GAGGIGFDVSEFLTTEDSPTLHLKEWRQEWGVSDPVDPARGGPRGGIVAPKPGPSPREV
FT                   YLLARTPGPLGRKLGKTSGWVHRAAIKAKKVVQLSGVNYEKIDDQGLHITFGEEHKDPR
FT                   VLEVDNVVICAGQESQRGLYDELVAKGVRAHVVGGALLAGELDAKRAIRQGTELAAAL"
     MNTSIRRPAA EQPALPYPNL LSELDLGRTR LKNRVVMGSM HTGYEDYPWM IDKLAAYYGE        60
     RAAGGVGLIV TGGYAPNYLG STVPLFGQFT TKLVAKSHRK ITDAVHEHGA KILLQILHTG       120
     RYAFHPLAVS ASATSAPTTP FRAWKMPGWL IRSTIRDYAR AAKLAKAAGY DGIEVMGGEG       180
     YLINQFLAPL TNKRTDEWGG TPQKRRRFPV EITRQIRAAV GPDFILQFRI SLVDYVPEGQ       240
     TWEEIVALAK ELEEAGVDIF NTDIGWHEAR VPTIVTSVPS GAFVEYTHAL AQQVDVPVIA       300
     SNRINMPEAA EQILAETDVD LISMARPLLA DPNWVNKAKA GQSDLINTCI ACNQACLDHA       360
     FAHKTVSCLL NPRAGRETQL QLLPTRKAKK VAVVGAGPAG LATAVSLAER GHSVTLIEGD       420
     DRIGGQFLIA SKIPGKEEFR HTLRYFQKQL EHHKVQVRLN TRITAAQLSA EGFDDVVVAT       480
     GVAPRMPRIP GVEHPMVLSY ADVVKEGKPV GKRVAVIGAG GIGFDVSEFL TTEDSPTLHL       540
     KEWRQEWGVS DPVDPARGGP RGGIVAPKPG PSPREVYLLA RTPGPLGRKL GKTSGWVHRA       600
     AIKAKKVVQL SGVNYEKIDD QGLHITFGEE HKDPRVLEVD NVVICAGQES QRGLYDELVA       660
     KGVRAHVVGG ALLAGELDAK RAIRQGTELA AAL                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page