(data stored in ACNUC7421 zone)

EMBL: CP001958.PE357

CP001958.PE357       Location/Qualifiers
FT   CDS             complement(341452..341931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96850"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96850.1"
FT                   /translation="MRVFRADTMPPWWLGALSALGLGAAVASADFPMSRRERFLARAAR
FT                   IAGSAACAGAGAEQLRRAASLPPPIPISQRAGAAIACAASLSTTPLIGERCVDKAARAL
FT                   SARGASWPRARLGALIAATALLGELLQRFPAPPTPKTPPPRRRLVRPNPGTIIRN"
     MRVFRADTMP PWWLGALSAL GLGAAVASAD FPMSRRERFL ARAARIAGSA ACAGAGAEQL        60
     RRAASLPPPI PISQRAGAAI ACAASLSTTP LIGERCVDKA ARALSARGAS WPRARLGALI       120
     AATALLGELL QRFPAPPTPK TPPPRRRLVR PNPGTIIRN                              159
//

If you have problems or comments...

PBIL Back to PBIL home page