(data stored in ACNUC7421 zone)

EMBL: CP001958.PE360

CP001958.PE360       Location/Qualifiers
FT   CDS             complement(345806..346117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0366"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="KEGG: mva:Mvan_0739 putative monovalent cation/H+
FT                   antiporter subunit G; TIGRFAM: monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit; PFAM: Na+/H+ antiporter
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96853"
FT                   /db_xref="GOA:D6ZB94"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB94"
FT                   /inference="protein motif:TFAM:TIGR01300"
FT                   /protein_id="ADG96853.1"
FT                   /translation="MDLAAALFIFAGSVLALTAALGIVRFPDTLTRMHAAAKPQALGLV
FT                   LSCVGAAIRLRHSIDLGMLVLIALFALLTSPVLAHLIGRLAYRELLEDQAALQARQKL"
     MDLAAALFIF AGSVLALTAA LGIVRFPDTL TRMHAAAKPQ ALGLVLSCVG AAIRLRHSID        60
     LGMLVLIALF ALLTSPVLAH LIGRLAYREL LEDQAALQAR QKL                         103
//

If you have problems or comments...

PBIL Back to PBIL home page