(data stored in ACNUC7421 zone)

EMBL: CP001958.PE361

CP001958.PE361       Location/Qualifiers
FT   CDS             complement(346117..346386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0367"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   F"
FT                   /note="KEGG: mab:MAB_0632c putative monovalent cation/H+
FT                   antiporter subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96854"
FT                   /db_xref="GOA:D6ZB95"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB95"
FT                   /inference="similar to AA sequence:KEGG:MAB_0632c"
FT                   /protein_id="ADG96854.1"
FT                   /translation="MDWLWISSAVLLCAAALLTTWKVAFGPKTLDRLVSVDTLVAVVMC
FT                   ALNGWAAYSMDSTVVYGTTALSLLGFIGSLSVVRFRVKDKRRRS"
     MDWLWISSAV LLCAAALLTT WKVAFGPKTL DRLVSVDTLV AVVMCALNGW AAYSMDSTVV        60
     YGTTALSLLG FIGSLSVVRF RVKDKRRRS                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page