(data stored in ACNUC7421 zone)

EMBL: CP001958.PE364

CP001958.PE364       Location/Qualifiers
FT   CDS             complement(348478..348912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0370"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   nfa:nfa52910 putative monovalent cation/H+ antiporter
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96857"
FT                   /db_xref="GOA:D6ZB98"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB98"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADG96857.1"
FT                   /translation="MSANMTLVVLIGLLGATGVNLLLRRTLTKMLIGTILLGNAVNLLI
FT                   LAAGGPSGAPPIVGAAPGEPTADPLAQAMILTAIVISLGVAAFVLALAYRSYRLQTDED
FT                   VDDDVEDESVAQRAEFDGEAEPDDEPAKVDVGDTEGQLRT"
     MSANMTLVVL IGLLGATGVN LLLRRTLTKM LIGTILLGNA VNLLILAAGG PSGAPPIVGA        60
     APGEPTADPL AQAMILTAIV ISLGVAAFVL ALAYRSYRLQ TDEDVDDDVE DESVAQRAEF       120
     DGEAEPDDEP AKVDVGDTEG QLRT                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page