(data stored in ACNUC7421 zone)

EMBL: CP001958.PE366

CP001958.PE366       Location/Qualifiers
FT   CDS             complement(351812..353710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0372"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: nfa:nfa800 putative serine/threonine protein
FT                   kinase; PFAM: Serine/threonine-protein kinase-like domain;
FT                   PASTA domain containing protein; SMART: serine/threonine
FT                   protein kinase; Tyrosine- protein kinase, subgroup,
FT                   catalytic domain; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96859"
FT                   /db_xref="GOA:D6ZBA0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG96859.1"
FT                   /translation="MSTPKHLGGRYTLGEAIGYGGMSEVHIARDERLGRTVAIKLLRPD
FT                   LARDPRFYLRFRREAQNAAALNHPMIVSVFDTGESASDQGPMPYIVMEYVDGQTLREAL
FT                   QNGPLTTQEVLSWIADVAAALDFSHHNGIVHRDVKPGNIMIDKTGQVKVMDFGIARAIS
FT                   DATITATQTATVIGTAQYLSPEQARGETVDPRSDVYSLGCVLYELLAGAPPFTGDTPLA
FT                   IAYQHVREDPKPPSSLKKTLTPDIDAVVLKAMSKNPANRYQSAAELRSDVLKLLAGERP
FT                   SAPRVMSEAERNSLLSSGEITGPTHKPLREHGQPVAEPGSRPRGVYAALVVAVIAALVA
FT                   AYFAISNIHPVPAGYAMVPNVAGMSEQQATDALRTSGVRYKIDHQESVETKQGNAIGTT
FT                   PQGGSAVDKNAEVTLTISSGPGQTVVPDLRNVPYGEAITRLSAAGLVEDPNRPPPEFSD
FT                   EIDKDRVISTQPAANKTALKGTKVQLILSKGPENTQIPNVVGQQSDAATKAITDAGLAP
FT                   PAFVEQSSTEPYGKVLSQDPQPGSDAKRKSVVTLTISKGDQIAMPDLTGMTEQEARTAL
FT                   RKAGFSGQVTTQSTQGNGIILPDPNKVPGQIFRQDPAPGTAFPKLGTVTIDMYHSG"
     MSTPKHLGGR YTLGEAIGYG GMSEVHIARD ERLGRTVAIK LLRPDLARDP RFYLRFRREA        60
     QNAAALNHPM IVSVFDTGES ASDQGPMPYI VMEYVDGQTL REALQNGPLT TQEVLSWIAD       120
     VAAALDFSHH NGIVHRDVKP GNIMIDKTGQ VKVMDFGIAR AISDATITAT QTATVIGTAQ       180
     YLSPEQARGE TVDPRSDVYS LGCVLYELLA GAPPFTGDTP LAIAYQHVRE DPKPPSSLKK       240
     TLTPDIDAVV LKAMSKNPAN RYQSAAELRS DVLKLLAGER PSAPRVMSEA ERNSLLSSGE       300
     ITGPTHKPLR EHGQPVAEPG SRPRGVYAAL VVAVIAALVA AYFAISNIHP VPAGYAMVPN       360
     VAGMSEQQAT DALRTSGVRY KIDHQESVET KQGNAIGTTP QGGSAVDKNA EVTLTISSGP       420
     GQTVVPDLRN VPYGEAITRL SAAGLVEDPN RPPPEFSDEI DKDRVISTQP AANKTALKGT       480
     KVQLILSKGP ENTQIPNVVG QQSDAATKAI TDAGLAPPAF VEQSSTEPYG KVLSQDPQPG       540
     SDAKRKSVVT LTISKGDQIA MPDLTGMTEQ EARTALRKAG FSGQVTTQST QGNGIILPDP       600
     NKVPGQIFRQ DPAPGTAFPK LGTVTIDMYH SG                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page