(data stored in ACNUC7421 zone)

EMBL: CP001958.PE367

CP001958.PE367       Location/Qualifiers
FT   CDS             complement(353707..355227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0373"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: mgi:Mflv_0810 penicillin-binding protein,
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96860"
FT                   /db_xref="GOA:D6ZBA1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA1"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADG96860.1"
FT                   /translation="MNTSLRRIGLVLAWLAPLVLIANITYVQAWWSIDLRNNAHNKRAL
FT                   YREYSEPRGKITAGGTLLAYSDPSDDRFHYLRKYNEPLAYAPVTGYYSMLFDRTELELK
FT                   ENDVLNGKDSRLFSQRLLDFLASHGQRGGMVNTTIDAKLQEVAYRQLSSGCPGGCVGSV
FT                   VALDPKNGAILAMASSPSYDPNQLSSHNLDETAKYYESLSHDPNQPLLNRAIEQAYPPG
FT                   STFKIVTTAAALSYGISPDLKLTAAGSIPLPGTANATIPNYGGQACPDSIGGEVTLRQA
FT                   FAYSCNTAFVQLMTQKIPKADAVLRGMATQLQLTEKQSIPMSVVPSQLVSPEEPDLLQK
FT                   DPAALGQSVIGQRDVQLTPLMNAEITACVANGGFLARPFVVRQEFGPDLKPLSDDQTTR
FT                   SVLVPAMRPQTAKTLTDFMVESERRSGGKGKDPKLDIASKTGTADNPHNKSPYTWYVAF
FT                   APASRPVIALAVLVEGSDALGPGATGASVAGPIGRAVIAQALADGGRR"
     MNTSLRRIGL VLAWLAPLVL IANITYVQAW WSIDLRNNAH NKRALYREYS EPRGKITAGG        60
     TLLAYSDPSD DRFHYLRKYN EPLAYAPVTG YYSMLFDRTE LELKENDVLN GKDSRLFSQR       120
     LLDFLASHGQ RGGMVNTTID AKLQEVAYRQ LSSGCPGGCV GSVVALDPKN GAILAMASSP       180
     SYDPNQLSSH NLDETAKYYE SLSHDPNQPL LNRAIEQAYP PGSTFKIVTT AAALSYGISP       240
     DLKLTAAGSI PLPGTANATI PNYGGQACPD SIGGEVTLRQ AFAYSCNTAF VQLMTQKIPK       300
     ADAVLRGMAT QLQLTEKQSI PMSVVPSQLV SPEEPDLLQK DPAALGQSVI GQRDVQLTPL       360
     MNAEITACVA NGGFLARPFV VRQEFGPDLK PLSDDQTTRS VLVPAMRPQT AKTLTDFMVE       420
     SERRSGGKGK DPKLDIASKT GTADNPHNKS PYTWYVAFAP ASRPVIALAV LVEGSDALGP       480
     GATGASVAGP IGRAVIAQAL ADGGRR                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page