(data stored in ACNUC7421 zone)

EMBL: CP001958.PE373

CP001958.PE373       Location/Qualifiers
FT   CDS             360806..362431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0379"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mav:MAV_2874 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96866"
FT                   /db_xref="GOA:D6ZBA7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG96866.1"
FT                   /translation="MTDAQGNRLAAKISEAMLSTSADLVIMDAETREWSRFPWGEVHAR
FT                   AEAVAADLLDRADGPVGTLGLIGNPTVDIVASVLGAWLAGGSVSLFPGMVRGADLGRWA
FT                   ETTLGRCAQIGVRTIFSYGRELEQLRAVQSGVRTEDVARIGAKPRPQSFVPPRTGDDST
FT                   PAVLQNSSGSTGQPKTAILSRGAFLSNIAAVADRTLLGKEDVVCSWLPLYHDMGLITLV
FT                   SAMWAGAPLWLAPSGAFSAAPLKWLDWITESGATYVKAPNFAYDIIGRYGDKIDRGVDL
FT                   GTLRVAVSAAELIHCDSFERFLAATAPVGFNPGSAMTAYGLAEATCAVAASRPGAGARF
FT                   DDVSVTMPDGGQSRRRYARLGAALDGMRLRIAPPAAPVPAINGREVGEIEVTGACMMNG
FT                   YLGADPIRRDEWFKTGDLGYLLDGELVVVGRFKELIVLAGRNVYPTDIERAAASVEGVR
FT                   AGRVAAVGLDEGGLRPRLALALEYKGSDLDTARRRVVQRVAADCGIVPAEVVFAAPGEL
FT                   PVTTSGKLRRLDVKHMIETGGGLR"
     MTDAQGNRLA AKISEAMLST SADLVIMDAE TREWSRFPWG EVHARAEAVA ADLLDRADGP        60
     VGTLGLIGNP TVDIVASVLG AWLAGGSVSL FPGMVRGADL GRWAETTLGR CAQIGVRTIF       120
     SYGRELEQLR AVQSGVRTED VARIGAKPRP QSFVPPRTGD DSTPAVLQNS SGSTGQPKTA       180
     ILSRGAFLSN IAAVADRTLL GKEDVVCSWL PLYHDMGLIT LVSAMWAGAP LWLAPSGAFS       240
     AAPLKWLDWI TESGATYVKA PNFAYDIIGR YGDKIDRGVD LGTLRVAVSA AELIHCDSFE       300
     RFLAATAPVG FNPGSAMTAY GLAEATCAVA ASRPGAGARF DDVSVTMPDG GQSRRRYARL       360
     GAALDGMRLR IAPPAAPVPA INGREVGEIE VTGACMMNGY LGADPIRRDE WFKTGDLGYL       420
     LDGELVVVGR FKELIVLAGR NVYPTDIERA AASVEGVRAG RVAAVGLDEG GLRPRLALAL       480
     EYKGSDLDTA RRRVVQRVAA DCGIVPAEVV FAAPGELPVT TSGKLRRLDV KHMIETGGGL       540
     R                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page