(data stored in ACNUC7421 zone)

EMBL: CP001958.PE378

CP001958.PE378       Location/Qualifiers
FT   CDS             365729..370291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0384"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="KEGG: rop:ROP_35350 glutamate synthase large
FT                   subunit; PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamine amidotransferase class-II; glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96871"
FT                   /db_xref="GOA:D6ZBB2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBB2"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADG96871.1"
FT                   /translation="MNRSPSPQGLYHPSEEHDSCGVAMIVDIHGRRSHELVAKAIAALV
FT                   NLDHRGAAGAEPNTGDGAGALIQVPDRFLRAVAGFELPEVYATGIAFLPQGGSDAEQAA
FT                   RAVEKIVESEGLATLGWREVPVNDSSIGALARDAMPTFRQIFIADPRGQLDGLDLERRL
FT                   YIVRKRVEHELRWGDERVYFPSLSARTLVYKGMLTTLQLREFYTDLQDERVESAVAIVH
FT                   ARFSTNTFPSWPLAHPYRFIAHNGEINTVAGNSNWMRARESLIRSDVFGGPEAWQKIFP
FT                   IVTPGASDTARFDEVVELLTLAGRPLPHAMLMMVPEAWENNPDMPKAHRDFYRYHASLM
FT                   EPWDGPAAMCFTDGSLVGALLDRNGLRPGRVWVTDDEVMVASEAGAFPVAQEKIIQKTR
FT                   LRPGRMLLVNMAEGRIITDEEVKDELSAAQPYGEWLHEQIALRDLPERETVRMNHERVL
FT                   NRQQVFGYTTEDVNILIKPMAMTGQEGIGSMGTDTPIAALSERPRLLFDYFQQLFAQVT
FT                   NPPLDAIREEIVTSLYGSLGPERDVLNPEPLSCRQVQLEQPILSNDDLARLVAANDDGK
FT                   YPWLRSTVIPGLYPVAKGGDGIAAALDVIRSQASDAIAGGARLIVLSDRNSNESLAPIP
FT                   SLLLTAAVHHHLIREKTRTKIGLIVETGDAREVHHMAALLGCGAAAVNPYLALETLHDL
FT                   VERKLMPGFTYAKAEANYLKATSKGVLKIMSKMGISTLASYTGAQLFQVIGLDQGLVDE
FT                   YFTGLRSQLGGVGLAELAADVGVRHHRAFIERPEERAHRELEVGGEYQWRREGEYHLFN
FT                   PETVFKLQHSTRTGRYDVFKEYTRAVDERAEKIGTLRGLFEFDPRGRAPIPVEEVEPVS
FT                   EIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEDEDRFTPDENGDWRRSA
FT                   IKQVASGRFGVTSHYLANCTDIQIKMAQGAKPGEGGQLPGHKMYPWIAKTRHSTPGVGL
FT                   ISPPPHHDIYSIEDLAQLIYDLKNANPQARIHVKLVSEIGVGTVAAGVSKCHADVVLIS
FT                   GHDGGTGASPLNSLKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVVVAA
FT                   LLGAEEYGFATAPLVVEGCVMMRVCHLDTCPVGVATQNPVLRARFDAKPEFVVNFFEFV
FT                   AQEVRELLASLGFRTLQEAIGQSQHLNTSRALARWSGEKAGKLDLSPILHQPESPFMNQ
FT                   APYCTSKQEHGLEKALDQVLISQARDAIDNGAEVLIESKIGNLNRSVGTMLGYEVTKAH
FT                   GAAGLAEHAITVDFTGIAGNSFAAFVPKGVTLRLRGEANDYVGKGLSGGNVTIRPAEES
FT                   SDRLVAERNIIAGNVVLFGATSGHAFIRGMVGERFAVRNSGATAVVEGIGDHGCEYMTG
FT                   GKVVILGPVGRNFAAGMSGGVAYIYNPDTTLERRVNPEFVNLEDVDGSDQEWLRAILAR
FT                   HVDETGSSVASRALADWETERRNFVKVMPRDYKRVLITIERAKREGRDPNQAIMEATRG
FT                   "
     MNRSPSPQGL YHPSEEHDSC GVAMIVDIHG RRSHELVAKA IAALVNLDHR GAAGAEPNTG        60
     DGAGALIQVP DRFLRAVAGF ELPEVYATGI AFLPQGGSDA EQAARAVEKI VESEGLATLG       120
     WREVPVNDSS IGALARDAMP TFRQIFIADP RGQLDGLDLE RRLYIVRKRV EHELRWGDER       180
     VYFPSLSART LVYKGMLTTL QLREFYTDLQ DERVESAVAI VHARFSTNTF PSWPLAHPYR       240
     FIAHNGEINT VAGNSNWMRA RESLIRSDVF GGPEAWQKIF PIVTPGASDT ARFDEVVELL       300
     TLAGRPLPHA MLMMVPEAWE NNPDMPKAHR DFYRYHASLM EPWDGPAAMC FTDGSLVGAL       360
     LDRNGLRPGR VWVTDDEVMV ASEAGAFPVA QEKIIQKTRL RPGRMLLVNM AEGRIITDEE       420
     VKDELSAAQP YGEWLHEQIA LRDLPERETV RMNHERVLNR QQVFGYTTED VNILIKPMAM       480
     TGQEGIGSMG TDTPIAALSE RPRLLFDYFQ QLFAQVTNPP LDAIREEIVT SLYGSLGPER       540
     DVLNPEPLSC RQVQLEQPIL SNDDLARLVA ANDDGKYPWL RSTVIPGLYP VAKGGDGIAA       600
     ALDVIRSQAS DAIAGGARLI VLSDRNSNES LAPIPSLLLT AAVHHHLIRE KTRTKIGLIV       660
     ETGDAREVHH MAALLGCGAA AVNPYLALET LHDLVERKLM PGFTYAKAEA NYLKATSKGV       720
     LKIMSKMGIS TLASYTGAQL FQVIGLDQGL VDEYFTGLRS QLGGVGLAEL AADVGVRHHR       780
     AFIERPEERA HRELEVGGEY QWRREGEYHL FNPETVFKLQ HSTRTGRYDV FKEYTRAVDE       840
     RAEKIGTLRG LFEFDPRGRA PIPVEEVEPV SEIVKRFSTG AMSYGSISAE AHETLAIAMN       900
     RLGGRSNSGE GGEDEDRFTP DENGDWRRSA IKQVASGRFG VTSHYLANCT DIQIKMAQGA       960
     KPGEGGQLPG HKMYPWIAKT RHSTPGVGLI SPPPHHDIYS IEDLAQLIYD LKNANPQARI      1020
     HVKLVSEIGV GTVAAGVSKC HADVVLISGH DGGTGASPLN SLKHAGAPWE LGLAETQQTL      1080
     LLNGLRDRIV VQVDGQMKTG RDVVVAALLG AEEYGFATAP LVVEGCVMMR VCHLDTCPVG      1140
     VATQNPVLRA RFDAKPEFVV NFFEFVAQEV RELLASLGFR TLQEAIGQSQ HLNTSRALAR      1200
     WSGEKAGKLD LSPILHQPES PFMNQAPYCT SKQEHGLEKA LDQVLISQAR DAIDNGAEVL      1260
     IESKIGNLNR SVGTMLGYEV TKAHGAAGLA EHAITVDFTG IAGNSFAAFV PKGVTLRLRG      1320
     EANDYVGKGL SGGNVTIRPA EESSDRLVAE RNIIAGNVVL FGATSGHAFI RGMVGERFAV      1380
     RNSGATAVVE GIGDHGCEYM TGGKVVILGP VGRNFAAGMS GGVAYIYNPD TTLERRVNPE      1440
     FVNLEDVDGS DQEWLRAILA RHVDETGSSV ASRALADWET ERRNFVKVMP RDYKRVLITI      1500
     ERAKREGRDP NQAIMEATRG                                                  1520
//

If you have problems or comments...

PBIL Back to PBIL home page